General Information

  • ID:  hor001971
  • Uniprot ID:  P09683
  • Protein name:  Secretin
  • Gene name:  SCT
  • Organism:  Homo sapiens (Human)
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  Serum secretin levels are increased after single-meal ingestion.
  • Disease:  Diseases associated with SCT include Zollinger-Ellison Syndrome and Pancreas Disease.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0046659 digestive hormone activity
  • GO BP:  GO:0002024 diet induced thermogenesis; GO:0007165 signal transduction; GO:0007420 brain development; GO:0009992 intracellular water homeostasis; GO:0021766 hippocampus development; GO:0030157 pancreatic juice secretion; GO:0031667 response to nutrient levels
  • GO CC:  NA

Sequence Information

  • Sequence:  HSDGTFTSELSRLREGARLQRLLQGLV
  • Length:  27(28-54)
  • Propeptide:  MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
  • Signal peptide:  MAPRPLLLLLLLLGGSAA
  • Modification:  T27 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of gastric acid secretion;Regulation of pancreatic bicarbonate secretion;maintain the balance between water intake and excretion in the body;regulate the function of the central nervous system;enhances secretin-stimulated bile and bile secretio
  • Mechanism:  Be mediated by interaction with basolateral SR; The messenger system is cAMP
  • Cross BBB:  NA
  • Target:  SCTR
  • Target Unid:  P47872
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09683-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001971_AF2.pdbhor001971_ESM.pdb

Physical Information

Mass: 350437 Formula: C130H219N43O41
Absent amino acids: CIKMNPWY Common amino acids: L
pI: 10.25 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -44.81 Boman Index: -7193
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 101.11
Instability Index: 5345.93 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25332973
  • Title:  The physiological roles of secretin and its receptor