HORDB

ID: hor001971
Uniprot ID: P09683
Protein name: Secretin
Gene name: SCT
Organism: Homo sapiens (Human)
Family: Glucagon family
Source: Human
Expression: Serum secretin levels are increased after single-meal ingestion.
Disease: Diseases associated with SCT include Zollinger-Ellison Syndrome and Pancreas Disease.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0046659 digestive hormone activity
GO BP: GO:0002024 diet induced thermogenesis; GO:0007165 signal transduction; GO:0007420 brain development; GO:0009992 intracellular water homeostasis; GO:0021766 hippocampus development; GO:0030157 pancreatic juice secretion; GO:0031667 response to nutrient levels
GO CC: NA

Sequence: HSDGTFTSELSRLREGARLQRLLQGLV
Length: 27
Propeptide: MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Signal peptide: MAPRPLLLLLLLLGGSAA
Modification: T27 Valine amide
Glycosylation: NA
Mutagenesis: NA

Function: Regulation of gastric acid secretion;Regulation of pancreatic bicarbonate secretion;maintain the balance between water intake and excretion in the body;regulate the function of the central nervous system;enhances secretin-stimulated bile and bile secretion; as a therapy for ductopenic liver diseases;
Mechanism: Be mediated by interaction with basolateral SR; The messenger system is cAMP
Cross BBB: NA
Target: SCTR
Target Unid: P47872
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001971_AF2.pdb

hor001971_ESM.pdb

Mass:	350437	Formula:	C130H219N43O41
Absent amino acids:	CIKMNPWY	Common amino acids:	L
pI:	10.25	Basic residues:	5
Polar residues:	8	Hydrophobic residues:	9
Hydrophobicity:	-44.81	Boman Index:	-7193
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	101.11
Instability Index:	5345.93	Extinction Coefficient cystines:	0
Absorbance 280nm:	0